PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G086700.1
Common NamePHAVU_006G086700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 362aa    MW: 39798.6 Da    PI: 7.298
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G086700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-1660104147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r rWT eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
  Phvul.006G086700.1  60 RERWTDEEHKKFLEALKLHGRA-WRRIEEHVG-TKTAVQIRSHAQKF 104
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-1654107IPR009057Homeodomain-like
PROSITE profilePS5129421.17455109IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-957107IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-1658107IPR006447Myb domain, plants
SMARTSM007175.3E-1359107IPR001005SANT/Myb domain
PfamPF002495.7E-1460103IPR001005SANT/Myb domain
CDDcd001672.23E-1062105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MAIRDQSEFY RSPGGPSVGS GVSLSSGVHS VTHIQLNEQF SCGSDYALKV RKPYTITKQR  60
ERWTDEEHKK FLEALKLHGR AWRRIEEHVG TKTAVQIRSH AQKFFSKVLR DPTGSVTNTA  120
DSIEIPPPRP KRKPMHPYPR KLVETPNKET SIPEQLMKSS SLKSSDFDQE NQSPKSVLSG  180
AGSDSLSSSD SDTPNESLSP MSSISDIHTS DFTCAEPNTT SEEAGINADS SHDEKPLMKF  240
KLPTDESLCM KEDTTEESSS QTFKLFGITL FVTDPCKPSS PTIEACKPIP LNKRKGGGRL  300
ELLGHITPSE TSAISLLKVR VGPEACGKGF VPYERCMAGR ENKSSSVTND NREEQCIHLS  360
L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311990.0KT031199.1 Glycine max clone HN_CCL_153 MYB/HD-like transcription factor (Glyma11g33180.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146984.10.0hypothetical protein PHAVU_006G086700g
SwissprotF4KGY62e-59RVE1_ARATH; Protein REVEILLE 1
TrEMBLV7BPM10.0V7BPM1_PHAVU; Uncharacterized protein
STRINGGLYMA18G05050.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.14e-43MYB_related family protein